
We provide Fake Video Call Katrina Kaif online (apkid: com.fakecallandwallpaperkatrinakaif.fakecallandwallpaperkatrinakaif) in order to run this application in our online Android emulator.
Description:

Run this app named Fake Video Call Katrina Kaif using MyAndroid.
You can do it using our Android online emulator.
Fake videocall, chat call with Katrina Kaif app to helps to fun and fake chat and Video call with Katrina Kaif.
We added a lot of fake messages for users able to make a fake chat and fake Video call with Katrina Kaif .
Download it now!
if you are fan of Katrina Kaif and want to feel you are with them, this Katrina Kaif Fake Video Call App is A great way to prank your friends and family by making them think they're in a real call or chat with Katrina Kaif the famous Indian Actoress.
Fake call allows you to more then one option like fake Video call, fake audio call and fake chat with Katrina Kaif
we all know that Katrina Kaif craze in social media is very high, all the fans of Katrina Kaif, recently she was retired from industries but , craze of Katrina Kaif is on high.
and try to do like him, and want to look like him
Katrina Kaif born Katrina Turquotte; 16 July 1983 and is a British actress who works in Hindi-language films.
One of the highest-paid actresses in India, she has received accolades, including four Screen Awards and four Zee Cine Awards, in addition to three Filmfare nominations.
Though reception to her acting has varied, she is noted for her dancing ability in various successful songs.
When you feel lonely and boring then entertain yourself with fake calls from your idol.
Get and download this application for free.
You will feel how close you are to your idol.
If you are a loyal fan of Katrina Kaif, what about it.
Download immediately Katrina Kaif Call You ! Fake Video Call application to enjoy the moments of seeing the idol via Video call !!!
This app is for the fan of Katrina Kaif, because we have huge collection of Wallpaper in HD.
If you love Katrina Kaif's Wallpapers then is app is for you.
So stay with us on Katrina Kaif Wallpaper.
Best Wallpaper App is All about Download, Share and Set Wallpapers.
in this Fake call Katrina Kaif application, you find lots of images of Indian film actresses.
This HD Wallpapers of Katrina Kaif app made with high-quality wallpapers & images.
Features:
- Call a Video from Katrina Kaif
- Chat online with Katrina Kaif
- Opportunity to do a private live with Katrina Kaif
- Select the cellphone that is approaching the call screen
- Plan instant fake calls whenever you need
- Multiple categories and Ability to have a Video call.
- Ability to send fake text messages to a Katrina Kaif.
about permissions :
if we are asking for any permissions inside app, it just for access the features, not for any other purpose.
Disclaimer :
This app is purely fictional and is not an official app.
It is fanmade! In other words, it is a 100% fake and fictional simulation
Materials included in the application do not reflect the app creators thoughts and ideas.
this app is mainly for entertainment and for all fans to enjoy these Katrina Kaif Video Calls
if you have and question and If we have violated any copyright
by using any image included in this app please contact us at bellow mail
All Images\videos Used In This App Are Believed To Be In Public Domain.
If You Own Rights To Any Of The Images, And Do Not
Wish Them To Appear Here, Please Contact Us And They Will Be
Removed.
If you like this app, rate us and perhaps write us a few lines.
Your feedback will be much appreciated.
Privacy Policy
https: //crazyapphub.wordpress.com/
We added a lot of fake messages for users able to make a fake chat and fake Video call with Katrina Kaif .
Download it now!
if you are fan of Katrina Kaif and want to feel you are with them, this Katrina Kaif Fake Video Call App is A great way to prank your friends and family by making them think they're in a real call or chat with Katrina Kaif the famous Indian Actoress.
Fake call allows you to more then one option like fake Video call, fake audio call and fake chat with Katrina Kaif
we all know that Katrina Kaif craze in social media is very high, all the fans of Katrina Kaif, recently she was retired from industries but , craze of Katrina Kaif is on high.
and try to do like him, and want to look like him
Katrina Kaif born Katrina Turquotte; 16 July 1983 and is a British actress who works in Hindi-language films.
One of the highest-paid actresses in India, she has received accolades, including four Screen Awards and four Zee Cine Awards, in addition to three Filmfare nominations.
Though reception to her acting has varied, she is noted for her dancing ability in various successful songs.
When you feel lonely and boring then entertain yourself with fake calls from your idol.
Get and download this application for free.
You will feel how close you are to your idol.
If you are a loyal fan of Katrina Kaif, what about it.
Download immediately Katrina Kaif Call You ! Fake Video Call application to enjoy the moments of seeing the idol via Video call !!!
This app is for the fan of Katrina Kaif, because we have huge collection of Wallpaper in HD.
If you love Katrina Kaif's Wallpapers then is app is for you.
So stay with us on Katrina Kaif Wallpaper.
Best Wallpaper App is All about Download, Share and Set Wallpapers.
in this Fake call Katrina Kaif application, you find lots of images of Indian film actresses.
This HD Wallpapers of Katrina Kaif app made with high-quality wallpapers & images.
Features:
- Call a Video from Katrina Kaif
- Chat online with Katrina Kaif
- Opportunity to do a private live with Katrina Kaif
- Select the cellphone that is approaching the call screen
- Plan instant fake calls whenever you need
- Multiple categories and Ability to have a Video call.
- Ability to send fake text messages to a Katrina Kaif.
about permissions :
if we are asking for any permissions inside app, it just for access the features, not for any other purpose.
Disclaimer :
This app is purely fictional and is not an official app.
It is fanmade! In other words, it is a 100% fake and fictional simulation
Materials included in the application do not reflect the app creators thoughts and ideas.
this app is mainly for entertainment and for all fans to enjoy these Katrina Kaif Video Calls
if you have and question and If we have violated any copyright
by using any image included in this app please contact us at bellow mail
All Images\videos Used In This App Are Believed To Be In Public Domain.
If You Own Rights To Any Of The Images, And Do Not
Wish Them To Appear Here, Please Contact Us And They Will Be
Removed.
If you like this app, rate us and perhaps write us a few lines.
Your feedback will be much appreciated.
Privacy Policy
https: //crazyapphub.wordpress.com/
MyAndroid is not a downloader online for Fake Video Call Katrina Kaif. It only allows to test online Fake Video Call Katrina Kaif with apkid com.fakecallandwallpaperkatrinakaif.fakecallandwallpaperkatrinakaif. MyAndroid provides the official Google Play Store to run Fake Video Call Katrina Kaif online.
©2025. MyAndroid. All Rights Reserved.
By OffiDocs Group OU – Registry code: 1609791 -VAT number: EE102345621.